| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ERAB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.05 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ERAB Antibody from Novus Biologicals is a mouse polyclonal antibody to ERAB. This antibody reacts with human. The ERAB Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | HSD17B10 (NP_004484.1, 1 a.a. - 261 a.a.) full-length human protein. MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP |
|---|
| Other Names | 17-beta-HSD 10, 17-beta-hydroxysteroid dehydrogenase 10, 17b-HSD10, 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, ABAD, amyloid-beta peptide binding alcohol dehydrogenase, CAMR, DUPXp11.22, EC 1.1.1.178, EC 1.1.1.35, Endoplasmic reticulum-associated amyloid beta-peptide-binding protein, ERAB3-hydroxyacyl-CoA dehydrogenase type-2, HADH2AB-binding alcohol dehydrogenase, hydroxyacyl-Coenzyme A dehydrogenase, type II, hydroxyacyl-Coenzyme Adehydrogenase, type II, hydroxysteroid (17-beta) dehydrogenase 10, mental retardation, X-linked, syndromic 10, MHBD, Mitochondrial ribonuclease P protein 2,3-hydroxyacyl-CoA dehydrogenase type II, Mitochondrial RNase P protein 2, MRPP2HCD2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, short chain dehydrogenase/reductase family 5C, member 1, short chain L-3-hydroxyacyl-CoA dehydrogenase type 2, short chain type dehydrogenase/reductase XH98G2, Short-chain type dehydrogenase/reductase XH98G2, Type II HADH, XH98G2 |
|---|
| Gene, Accession # | HSD17B10, Gene ID: 3028, Accession: NP_004484.1, SwissProt: NP_004484.1 |
|---|
| Catalog # | H00003028-B01P |
|---|
| Price | |
|---|
| Order / More Info | ERAB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|