| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BCAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BCAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCAT2. This antibody reacts with human. The BCAT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BCAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML |
|---|
| Other Names | BCAM, BCAT(m), BCATM, BCT2EC 2.6.1.42, branched chain amino-acid transaminase 2, mitochondrial, branched chain aminotransferase 2, mitochondrial, branched-chain-amino-acid aminotransferase, mitochondrial, ECA40, Placental protein 18, PP18 |
|---|
| Gene, Accession # | BCAT2, Gene ID: 587, Accession: O15382, SwissProt: O15382 |
|---|
| Catalog # | NBP2-33705 |
|---|
| Price | |
|---|
| Order / More Info | BCAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|