| Edit |   |
| Antigenic Specificity | Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids, however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis. |
| Immunogen | ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK |
| Other Names | ACSBG2|fk81d02|im:7046047|sb:cb76|si:dkey-240a9.3|wu:fj55d04|wu:fk81d02|BGR|BRGL|PRTD-NY3|PRTDNY3|Bgr |
| Gene, Accession # | Gene ID: 81616 |
| Catalog # | ABIN631171 |
| Price | |
| Order / More Info | Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |