| Edit |   |
| Antigenic Specificity | Adenylate Kinase 1 (AK1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. |
| Immunogen | AK1 antibody was raised using the N terminal of AK1 corresponding to a region with amino acids HLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVN |
| Other Names | ADK-1|AK1|CG17146|DAK1|Dak1|Dmel\\CG17146|adk1|bs34e10.y1|ak5|ADENYLATE KINASE 1|MLE2.3|MLE2_3|adenylate kinase 1|Ak-1|B430205N08Rik|Ak 1|zgc:91930|Myokinase |
| Gene, Accession # | Gene ID: 203 |
| Catalog # | ABIN631113 |
| Price | |
| Order / More Info | Adenylate Kinase 1 (AK1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |