| Edit |   |
|---|
| Antigenic Specificity | Adenylate Kinase 4 (AK4) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix. |
|---|
| Immunogen | AK3 L1 antibody was raised using the N terminal of AK3 1 corresponding to a region with amino acids MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEV |
|---|
| Other Names | AK3L1|AK6|AKL3L|AKL3L1|FIX|AA407498|AI506714|AK-3|Ak3l|Ak3l1|Akl3l|AK 4|AK4|AK3|Ak3l2|AK3L2|Ak-3|Ak-4|Ak3|D4Ertd274e |
|---|
| Gene, Accession # | Gene ID: 50808 |
|---|
| Catalog # | ABIN631000 |
|---|
| Price | |
|---|
| Order / More Info | Adenylate Kinase 4 (AK4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|