| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Catenin alpha 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Catenin alpha 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Catenin alpha 1. This antibody reacts with human. The Catenin alpha 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Catenin alpha 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK |
|---|
| Other Names | Alpha E-catenin, alpha-catenin, alpha-E-catenin, alphaE-catenin, Cadherin-associated protein, CAP102, catenin (cadherin-associated protein), alpha 1 (102kD), catenin (cadherin-associated protein), alpha 1, 102kDa, catenin alpha-1, FLJ36832, FLJ52416, Renal carcinoma antigen NY-REN-13 |
|---|
| Gene, Accession # | CTNNA1, Gene ID: 1495, Accession: P35221, SwissProt: P35221 |
|---|
| Catalog # | NBP2-33456 |
|---|
| Price | |
|---|
| Order / More Info | Catenin alpha 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|