| Edit |   |
| Antigenic Specificity | DYRK1A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DYRK1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to DYRK1A. This antibody reacts with human. The DYRK1A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DYRK1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQ |
| Other Names | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, DYRK1, MNBEC 2.7.110EC 2.7.12 |
| Gene, Accession # | DYRK1A, Gene ID: 1859, Accession: Q13627, SwissProt: Q13627 |
| Catalog # | NBP1-84031 |
| Price | |
| Order / More Info | DYRK1A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |