| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DYRK1A |
|---|
| Clone | 7D10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation. This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. IP usage reported in scientific literature (PMID 25368549). IHC usage reported in scientific literature (PMID 23220201). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DYRK1A Antibody (7D10) from Novus Biologicals is a mouse monoclonal antibody to DYRK1A. This antibody reacts with human, mouse. The DYRK1A Antibody (7D10) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation. |
|---|
| Immunogen | DYRK1A (NP_001387 674 a.a. - 763 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS |
|---|
| Other Names | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, DYRK1, MNBEC 2.7.110EC 2.7.12 |
|---|
| Gene, Accession # | DYRK1A, Gene ID: 1859, Accession: Q13627, SwissProt: Q13627 |
|---|
| Catalog # | H00001859-M01 |
|---|
| Price | |
|---|
| Order / More Info | DYRK1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18678649, 19059382, 19242551, 19549690, 19801542, 19844572, 19906449, 20167603, 2060090, 20600907, 21843906, 21878370, 22214338, 22250195, 22293606, 22354171, 22700376, 22923366, 22962634, 23103828, 23220201, 23342120, 23429073, 23512985, 23825664, 23969234, 24366666, 24375627, 24453307, 24477974, 24819931, 25116835, 25188425, 25368549, 26008897, 26137553, 26206885, 26363314, 26373433, 26641855, 27307198, 27686255, 27896129, 28540658, 28632203 |
|---|
| 产品资料 |
|
|