| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Amiloride-sensitive cation channel 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Amiloride-sensitive cation channel 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Amiloride-sensitive cation channel 3. This antibody reacts with human. The Amiloride-sensitive cation channel 3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRM |
|---|
| Other Names | Acid-sensing ion channel 3, amiloride-sensitive cation channel 3, amiloride-sensitive cation channel 3, testis, ASIC3hTNaC1, DRASIC, hASIC3, modulatory subunit of ASIC2a, Neuronal amiloride-sensitive cation channel 3, proton-gated cation channel subunit, SLNAC1, Testis sodium channel 1, TNAC1 |
|---|
| Gene, Accession # | ASIC3, Gene ID: 9311 |
|---|
| Catalog # | NBP2-62624 |
|---|
| Price | |
|---|
| Order / More Info | Amiloride-sensitive cation channel 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|