| Edit |   |
|---|
| Antigenic Specificity | Amiloride-sensitive cation channel 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Amiloride-sensitive cation channel 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Amiloride-sensitive cation channel 3. This antibody reacts with human. The Amiloride-sensitive cation channel 3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Amiloride-sensitive cation channel 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRDKVLGYFWNRQHSQRHSSTNLLQEGLGSHRTQVPHLSLGPRPPTPPCA VTKTLSASHRTCYLVTQL |
|---|
| Other Names | Acid-sensing ion channel 3, amiloride-sensitive cation channel 3, amiloride-sensitive cation channel 3, testis, ASIC3hTNaC1, DRASIC, hASIC3, modulatory subunit of ASIC2a, Neuronal amiloride-sensitive cation channel 3, proton-gated cation channel subunit, SLNAC1, Testis sodium channel 1, TNAC1 |
|---|
| Gene, Accession # | ASIC3, Gene ID: 9311, Accession: Q9UHC3, SwissProt: Q9UHC3 |
|---|
| Catalog # | NBP2-14322 |
|---|
| Price | |
|---|
| Order / More Info | Amiloride-sensitive cation channel 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|