| Edit |   |
|---|
| Antigenic Specificity | Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. |
|---|
| Immunogen | ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD |
|---|
| Other Names | ACCN5|HINAC|INAC|Accn5|Blinac|Inac |
|---|
| Gene, Accession # | Gene ID: 51802 |
|---|
| Catalog # | ABIN630083 |
|---|
| Price | |
|---|
| Order / More Info | Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|