| Edit |   |
|---|
| Antigenic Specificity | Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium. |
|---|
| Immunogen | ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV |
|---|
| Other Names | ACCN|ACCN1|ASIC2a|BNC1|BNaC1|MDEG|hBNaC1|ACIC2|Accn1|BNaC1a|Mdeg|BNC1k|MDEG1|MDEG2|accn1|zASIC2|BNC|BSN1|HsT19447|AI047752|AW546376|Bnc |
|---|
| Gene, Accession # | Gene ID: 40,49115 |
|---|
| Catalog # | ABIN633674 |
|---|
| Price | |
|---|
| Order / More Info | Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|