| Edit |   |
| Antigenic Specificity | ANGEL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ANGEL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANGEL1. This antibody reacts with mouse. The ANGEL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human Angel1The immunogen for this antibody is Angel1. Peptide sequence SPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITD. |
| Other Names | angel homolog 1 (Drosophila), FLJ60172, KIAA0759, protein angel homolog 1 |
| Gene, Accession # | ANGEL1, Gene ID: 23357, Accession: NP_653107 |
| Catalog # | NBP1-79580 |
| Price | |
| Order / More Info | ANGEL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |