| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Oocyte Expressed Protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Oocyte Expressed Protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to Oocyte Expressed Protein. This antibody reacts with human. The Oocyte Expressed Protein Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Oocyte Expressed Protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQD |
|---|
| Other Names | C6orf156, Chromosome 6 Open Reading Frame 156, FLOPED, HOEP19, KH Homology Domain Containing 2, KH Homology Domain-Containing Protein 2, KHDC2, OEP19, Oocyte And Embryo Protein 19, Oocyte- And Embryo-Specific Protein 19, Oocyte Expressed Protein Homolog (Dog), Oocyte-Expressed Protein Homolog, OOEP |
|---|
| Gene, Accession # | OOEP, Gene ID: 441161, Accession: A6NGQ2, SwissProt: A6NGQ2 |
|---|
| Catalog # | NBP2-30762 |
|---|
| Price | |
|---|
| Order / More Info | Oocyte Expressed Protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|