| Edit |   |
|---|
| Antigenic Specificity | OOEP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 45%, rat 43%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human OOEP polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQD |
|---|
| Other Names | oocyte expressed protein, C6orf156, Em:AC019205.2, KHDC2 |
|---|
| Gene, Accession # | Gene ID: 441161, UniProt: A6NGQ2, ENSG00000203907 |
|---|
| Catalog # | HPA055165 |
|---|
| Price | |
|---|
| Order / More Info | OOEP Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|