| Edit |   |
|---|
| Antigenic Specificity | BTB (POZ) Domain Containing 10 (BTBD10) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation. |
|---|
| Immunogen | BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL |
|---|
| Other Names | RGD1306301|GMRP-1|GMRP1|1110056N09Rik|Gmrp1 |
|---|
| Gene, Accession # | Gene ID: 84280 |
|---|
| Catalog # | ABIN633657 |
|---|
| Price | |
|---|
| Order / More Info | BTB (POZ) Domain Containing 10 (BTBD10) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|