| Edit |   |
|---|
| Antigenic Specificity | Arachidonate 12-Lipoxygenase (ALOX12) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity. |
|---|
| Immunogen | ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF |
|---|
| Other Names | ALOX12|zgc:64120|wu:fb72a11|12-LOX|12S-LOX|LOG12|9930022G08Rik|Alox12p|P-12LO|ALOX15|12-LO |
|---|
| Gene, Accession # | Gene ID: 239 |
|---|
| Catalog # | ABIN631808 |
|---|
| Price | |
|---|
| Order / More Info | Arachidonate 12-Lipoxygenase (ALOX12) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|