| Edit |   |
|---|
| Antigenic Specificity | Arachidonate 15-Lipoxygenase (ALOX15) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid. |
|---|
| Immunogen | ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL |
|---|
| Other Names | ALOX15|15-LOX-1|15LOX-1|ALOX12|15-LOX|12-LO|Alox12l|L-12LO|12-LOX|Alox12 |
|---|
| Gene, Accession # | Gene ID: 246 |
|---|
| Catalog # | ABIN634401 |
|---|
| Price | |
|---|
| Order / More Info | Arachidonate 15-Lipoxygenase (ALOX15) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|