| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAGE 1 |
|---|
| Clone | 3H5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAGE 1 Antibody (3H5) from Novus Biologicals is a mouse monoclonal antibody to MAGE 1. This antibody reacts with human. The MAGE 1 Antibody (3H5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MAGEA1 (NP_004979, 98 a.a. - 171 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVL |
|---|
| Other Names | Antigen MZ2-E, Cancer/testis antigen 1.1, cancer/testis antigen family 1, member 1, CT1.1melanoma antigen family A 1, MAGE-1 antigen, MAGE1A, MAGE1melanoma antigen MAGE-1, melanoma antigen family A, 1 (directs expression of antigen MZ2-E), melanoma-associated antigen 1, melanoma-associated antigen MZ2-E, MGC9326 |
|---|
| Gene, Accession # | MAGEA1, Gene ID: 4100, Accession: NP_004979, SwissProt: NP_004979 |
|---|
| Catalog # | H00004100-M01 |
|---|
| Price | |
|---|
| Order / More Info | MAGE 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|