| Edit |   |
|---|
| Antigenic Specificity | CTIF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CTIF Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTIF. This antibody reacts with human. The CTIF Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIAA0427(KIAA0427) The peptide sequence was selected from the N terminal of KIAA0427. Peptide sequence QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN. |
|---|
| Other Names | CBP80/20-dependent translation initiation factor, KIAA0427Gm672 |
|---|
| Gene, Accession # | CTIF, Gene ID: 9811, Accession: O43310, SwissProt: O43310 |
|---|
| Catalog # | NBP1-57423 |
|---|
| Price | |
|---|
| Order / More Info | CTIF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|