| Edit |   |
| Antigenic Specificity | CTIF |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CTIF Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTIF. This antibody reacts with human. The CTIF Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KIAA0427(KIAA0427) The peptide sequence was selected from the N terminal of KIAA0427. Peptide sequence QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN. |
| Other Names | CBP80/20-dependent translation initiation factor, KIAA0427Gm672 |
| Gene, Accession # | CTIF, Gene ID: 9811, Accession: O43310, SwissProt: O43310 |
| Catalog # | NBP1-57423 |
| Price | |
| Order / More Info | CTIF Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |