| Edit |   |
|---|
| Antigenic Specificity | DOC2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 97%, rat 97%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human DOC2B polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LKKLKPNHTKTFSICLEKQLPVDKTEDKSLEE |
|---|
| Other Names | double C2-like domains, beta, DOC2BL |
|---|
| Gene, Accession # | Gene ID: 8447, UniProt: None, ENSG00000272636 |
|---|
| Catalog # | HPA043168 |
|---|
| Price | |
|---|
| Order / More Info | DOC2B Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|