| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCC9 |
|---|
| Clone | S323A-31 |
|---|
| Host Species | Recombinant Mouse |
|---|
| Reactive Species | mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | unconjugated |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | WB, IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse Anti-ABCC9 Recombinant Antibody (S323A-31). This product is a mouse antibody that recognizes ABCC9. The antibody S323A-31 can be used for immunoassay techniques such as: WB, IF. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-bind |
|---|
| Immunogen | Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B |
|---|
| Other Names | AI414027; AI449286; SUR2A; SUR2B; Sur2 |
|---|
| Gene, Accession # | Gene ID: 20928, UniProt: P70170 |
|---|
| Catalog # | CBMAB-S0002-CQ |
|---|
| Price | |
|---|
| Order / More Info | ABCC9 Antibody from CREATIVE BIOLABS |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|