| 产品详情 |
| Edit |   |
| Antigenic Specificity | Aldo-keto Reductase 1C1/AKR1C1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Aldo-keto Reductase 1C1/AKR1C1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aldo-keto Reductase 1C1/AKR1C1. This antibody reacts with human. The Aldo-keto Reductase 1C1/AKR1C1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptide directed towards the N terminal of human AKR1C1. Peptide sequence: LERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATW |
| Other Names | 20 alpha-hydroxysteroid dehydrogenase, 20-ALPHA-HSD, 20-alpha-hydroxysteroid dehydrogenase, aldo-keto reductase family 1 member C1, aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase), C9, Chlordecone reductase homolog HAKRC, DD1/DD2, DD1MGC8954, DDHH-37, dihydrodiol dehydrogenase 1, Dihydrodiol dehydrogenase 1/2, dihydrodiol dehydrogenase isoform DD1, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.112, EC 1.1.1.149,2-ALPHA-HSD, EC 1.3.1.20, HAKRCDDH1aldo-keto reductase C, HBAB, hepatic dihydrodiol dehydrogenase, High-affinity hepatic bile acid-binding protein, Indanol dehydrogenase, MBAB, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II 3-alpha-hydroxysteroid dehydrogenase |
| Gene, Accession # | AKR1C1, Gene ID: 1645, Accession: Q04828, SwissProt: Q04828 |
| Catalog # | NBP1-68878-20ul |
| Price | |
| Order / More Info | Aldo-keto Reductase 1C1/AKR1C1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|