| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RelA/NFkB p65 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RelA/NFkB p65 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RelA/NFkB p65. This antibody reacts with human. The RelA/NFkB p65 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RelA/NFkB p65 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC |
|---|
| Other Names | MGC131774, nf kb p65, NFkB p65, NF-kB p65, NFKB3v-rel avian reticuloendotheliosis viral oncogene homolog A (nuclear factor ofkappa light polypeptide gene enhancer in B-cells 3 (p65)), Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3transcription factor p65, p65, RelA, rela p65, v-rel reticuloendotheliosis viral oncogene homolog A (avian), v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappalight polypeptide gene enhancer in B-cells 3, p65 |
|---|
| Gene, Accession # | RELA, Gene ID: 5970 |
|---|
| Catalog # | NBP2-56067 |
|---|
| Price | |
|---|
| Order / More Info | RelA/NFkB p65 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|