| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBP3. This antibody reacts with human. The RBP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RBP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSK |
|---|
| Other Names | D10S64, D10S65, D10S66, Interphotoreceptor retinoid-binding protein, Interstitial retinol-binding protein, IRBP, RBPI, retinol binding protein 3, interstitial, retinol-binding protein 3, retinol-binding protein 3, interstitial |
|---|
| Gene, Accession # | RBP3, Gene ID: 5949 |
|---|
| Catalog # | NBP2-58200 |
|---|
| Price | |
|---|
| Order / More Info | RBP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|