| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBP3 |
|---|
| Clone | 4F3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBP3 Antibody (4F3) from Novus Biologicals is a mouse monoclonal antibody to RBP3. This antibody reacts with human. The RBP3 Antibody (4F3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | RBP3 (NP_002891 1149 a.a. - 1246 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH |
|---|
| Other Names | D10S64, D10S65, D10S66, Interphotoreceptor retinoid-binding protein, Interstitial retinol-binding protein, IRBP, RBPI, retinol binding protein 3, interstitial, retinol-binding protein 3, retinol-binding protein 3, interstitial |
|---|
| Gene, Accession # | RBP3, Gene ID: 5949, Accession: NP_002891, SwissProt: NP_002891 |
|---|
| Catalog # | H00005949-M01 |
|---|
| Price | |
|---|
| Order / More Info | RBP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|