| Edit |   |
| Antigenic Specificity | ANKRD5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ANKRD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD5. This antibody reacts with human. The ANKRD5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ANKRD5 (ankyrin repeat domain 5) The peptide sequence was selected from the middle region of ANKRD5)(50ug). Peptide sequence LDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK. |
| Other Names | ankyrin repeat domain 5, ankyrin repeat domain-containing protein 5, dJ839B4.6, FLJ21669 |
| Gene, Accession # | ANKRD5, Gene ID: 63926, Accession: Q9NU02, SwissProt: Q9NU02 |
| Catalog # | NBP1-56450-20ul |
| Price | |
| Order / More Info | ANKRD5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |