| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B7-H2/ICOSLG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B7-H2/ICOSLG Antibody from Novus Biologicals is a rabbit polyclonal antibody to B7-H2/ICOSLG. This antibody reacts with human. The B7-H2/ICOSLG Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT |
|---|
| Other Names | B7H2B7 homolog 2, B7-H2B7-related protein 1, B7RP1B7-like protein Gl50, B7RP-1LICOS, CD275, CD275 antigen, GL50transmembrane protein B7-H2 ICOS ligand, ICOSL, ICOS-L, inducible T-cell co-stimulator ligand, KIAA0653ICOS ligand |
|---|
| Gene, Accession # | ICOSLG, Gene ID: 23308 |
|---|
| Catalog # | NBP2-68606 |
|---|
| Price | |
|---|
| Order / More Info | B7-H2/ICOSLG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|