| Edit |   |
|---|
| Antigenic Specificity | Pellino Homolog 1 (Drosophila) (PELI1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1. |
|---|
| Immunogen | PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA |
|---|
| Other Names | 2810468L03Rik|A930031K15Rik|AA409794|AI586297|D11Ertd676e |
|---|
| Gene, Accession # | Gene ID: 57162 |
|---|
| Catalog # | ABIN632023 |
|---|
| Price | |
|---|
| Order / More Info | Pellino Homolog 1 (Drosophila) (PELI1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|