| Edit |   |
|---|
| Antigenic Specificity | Toll-Like Receptor 9 (TLR9) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. |
|---|
| Immunogen | TLR9 antibody was raised using the N terminal of TLR9 corresponding to a region with amino acids VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN |
|---|
| Other Names | CD289 |
|---|
| Gene, Accession # | Gene ID: 54106 |
|---|
| Catalog # | ABIN634525 |
|---|
| Price | |
|---|
| Order / More Info | Toll-Like Receptor 9 (TLR9) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|