| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1H |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 26168401). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1H Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V1H. This antibody reacts with human. The ATP6V1H Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ATP6V1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE |
|---|
| Other Names | ATPase, H+ transporting, lysosomal 50/57kD, V1 subunit H, ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, CGI-11, MSTP042, NBP1, Nef-binding protein 1, Protein VMA13 homolog, SFD, SFDalpha, SFDbeta, vacuolar ATP synthase subunit H, vacuolar ATPase subunit H, vacuolar proton pump H subunit, Vacuolar proton pump subunit H, Vacuolar proton pump subunit SFD, V-ATPase 50/57 kDa subunits, V-ATPase H subunit, V-ATPase subunit H, VMA13, V-type proton ATPase subunit H |
|---|
| Gene, Accession # | ATP6V1H, Gene ID: 51606 |
|---|
| Catalog # | NBP1-85668 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1H Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26168401 |
|---|
| 产品资料 |
|
|