| Edit |   |
|---|
| Antigenic Specificity | ARL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL1. This antibody reacts with human. The ARL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is ARL1 - C-terminal region. Peptide sequence: SKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRK |
|---|
| Other Names | ADP-ribosylation factor-like 1, ADP-ribosylation factor-like protein 1, ARFL1 |
|---|
| Gene, Accession # | ARL1, Gene ID: 400, Accession: NP_001168, SwissProt: NP_001168 |
|---|
| Catalog # | NBP1-98485 |
|---|
| Price | |
|---|
| Order / More Info | ARL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|