| Edit |   |
| Antigenic Specificity | ARL10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARL10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL10. This antibody reacts with human. The ARL10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARL10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRF YWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVV |
| Other Names | ADP-ribosylation factor-like 10, ARL10A |
| Gene, Accession # | ARL10, Gene ID: 285598, Accession: Q8N8L6, SwissProt: Q8N8L6 |
| Catalog # | NBP2-14311 |
| Price | |
| Order / More Info | ARL10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |