| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1G1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1G1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V1G1. This antibody reacts with human. The ATP6V1G1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ATP6V1G1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR |
|---|
| Other Names | ATP6G1V-ATPase 13 kDa subunit 1, ATP6GATP6J, ATP6GL, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member J, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 1, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1, DKFZp547P234, vacuolar ATP synthase subunit M16, vacuolar H(+)-ATPase subunit G 1, Vacuolar proton pump subunit G 1, Vacuolar proton pump subunit M16, V-ATPase subunit G 1, Vma10, V-type proton ATPase subunit G 1 |
|---|
| Gene, Accession # | ATP6V1G1, Gene ID: 9550 |
|---|
| Catalog # | NBP2-55232 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1G1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|