| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1G2 |
|---|
| Clone | 2E11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2b lambda |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1G2 Antibody (2E11) from Novus Biologicals is a mouse monoclonal antibody to ATP6V1G2. This antibody reacts with human, mouse, rat. The ATP6V1G2 Antibody (2E11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ATP6V1G2 (NP_569730, 41 a.a. - 118 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA |
|---|
| Other Names | ATP6G2, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 2, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2, Em:AC004181.3, subunit G2, vacuolar ATP synthase subunit G 2, vacuolar proton pump G subunit 2, Vacuolar proton pump subunit G 2, V-ATPase 13 kDa subunit 2, V-ATPase subunit G 2, Vma10, V-type proton ATPase subunit G 2 |
|---|
| Gene, Accession # | ATP6V1G2, Gene ID: 534, Accession: NP_569730, SwissProt: NP_569730 |
|---|
| Catalog # | H00000534-M02 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1G2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|