| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1G2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1G2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V1G2. This antibody reacts with human. The ATP6V1G2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ATP6V1G2The immunogen for this antibody is ATP6V1G2. Peptide sequence NLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIS. |
|---|
| Other Names | ATP6G2, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 2, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2, Em:AC004181.3, subunit G2, vacuolar ATP synthase subunit G 2, vacuolar proton pump G subunit 2, Vacuolar proton pump subunit G 2, V-ATPase 13 kDa subunit 2, V-ATPase subunit G 2, Vma10, V-type proton ATPase subunit G 2 |
|---|
| Gene, Accession # | ATP6V1G2, Gene ID: 534, Accession: NP_569730, SwissProt: NP_569730 |
|---|
| Catalog # | NBP1-79685-20ul |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1G2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|