| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KLF4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for KLF4 detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Kruppel-like factor 4, also known as EZF or GKLF, is a protein that in humans is encoded by the KLF4 gene. This gene is mapped to 9q31.2. KLF4 gene encodes a member of the Kruppel family of transcription factors. This gene plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. It is required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. This gene involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human KLF4 (EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLA). |
|---|
| Other Names | Krueppel-like factor 4; Epithelial zinc finger protein EZF; Gut-enriched krueppel-like factor; KLF4; EZF; GKLF |
|---|
| Gene, Accession # | KLF4, UniProt: O43474 |
|---|
| Catalog # | A00120 |
|---|
| Price | |
|---|
| Order / More Info | KLF4 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|