| Edit |   |
| Antigenic Specificity | EXOC5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 92%, rat 92%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human EXOC5 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TVLAKLIQNVFEIKLQSFVKEQLEECRKSDAEQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTF |
| Other Names | exocyst complex component 5, SEC10, SEC10L1, SEC10P |
| Gene, Accession # | Gene ID: 10640, UniProt: O00471, ENSG00000070367 |
| Catalog # | HPA060837 |
| Price | |
| Order / More Info | EXOC5 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |