| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Complement Component C5a R1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Complement Component C5a R1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Complement Component C5a R1. This antibody reacts with human. The Complement Component C5a R1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Complement Component C5aR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV |
|---|
| Other Names | C5A, C5a anaphylatoxin chemotactic receptor, C5aR, C5a-R, C5ARC5a anaphylatoxin receptor, C5R1C5a ligand, CD88, CD88 antigen, complement component 5 receptor 1, complement component 5 receptor 1 (C5a ligand), complement component 5a receptor 1 |
|---|
| Gene, Accession # | C5AR1, Gene ID: 728 |
|---|
| Catalog # | NBP1-88258 |
|---|
| Price | |
|---|
| Order / More Info | Complement Component C5a R1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|