| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DEFB119 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DEFB119 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DEFB119. This antibody reacts with human. The DEFB119 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DEFB119 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP |
|---|
| Other Names | Beta-defensin 120, Beta-defensin 19, Beta-defensin 20, DEFB120, DEFB19, DEFB-19MGC71893, DEFB20, DEFB-20beta-defensin 119, defensin, beta 119ESC42-RELA, Defensin, beta 120ESC42-RELB, defensin, beta 19, defensin, beta 20 |
|---|
| Gene, Accession # | DEFB119, Gene ID: 245932 |
|---|
| Catalog # | NBP1-84280 |
|---|
| Price | |
|---|
| Order / More Info | DEFB119 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24598113 |
|---|
| 产品资料 |
|
|