| Edit |   |
| Antigenic Specificity | AKIP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AKIP Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKIP. This antibody reacts with human. The AKIP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AKIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR |
| Other Names | AIPAKIPaurora kinase A-interacting protein, AURKA-interacting protein, aurora kinase A interacting protein 1, aurora-A kinase interacting protein, FLJ20608 |
| Gene, Accession # | AURKAIP1, Gene ID: 54998, Accession: Q9NWT8, SwissProt: Q9NWT8 |
| Catalog # | NBP1-90202 |
| Price | |
| Order / More Info | AKIP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |