| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACADVL |
|---|
| Clone | 5D3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACADVL Antibody (5D3) from Novus Biologicals is a mouse monoclonal antibody to ACADVL. This antibody reacts with human, mouse. The ACADVL Antibody (5D3) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | ACADVL (NP_000009, 345 a.a. - 434 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI |
|---|
| Other Names | ACAD6, acyl-CoA dehydrogenase, very long chain, acyl-Coenzyme A dehydrogenase, very long chain, EC 1.3.99, EC 1.3.99.-, LCACD, very long-chain specific acyl-CoA dehydrogenase, mitochondrial, VLCAD |
|---|
| Gene, Accession # | ACADVL, Gene ID: 37, Accession: NP_000009, SwissProt: NP_000009 |
|---|
| Catalog # | H00000037-M01 |
|---|
| Price | |
|---|
| Order / More Info | ACADVL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22354779, 24158852 |
|---|
| 产品资料 |
|
|