| Edit |   |
|---|
| Antigenic Specificity | KCNA6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 56%, rat 56%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human KCNA6 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTG |
|---|
| Other Names | potassium voltage-gated channel, shaker-related subfamily, member 6, HBK2, Kv1.6, PPP1R96 |
|---|
| Gene, Accession # | Gene ID: None, UniProt: P17658, ENSG00000151079 |
|---|
| Catalog # | HPA014418 |
|---|
| Price | |
|---|
| Order / More Info | KCNA6 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|