| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BACH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BACH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BACH1. This antibody reacts with human. The BACH1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BACH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS |
|---|
| Other Names | basic region leucine zipper transcriptional regulator BACH1, BTB and CNC homolog 1, BTB and CNC homology 1, basic leucine zipper transcription factor 1, HA2303, transcription regulator protein BACH1, transcription regulator protein10BACH-1 |
|---|
| Gene, Accession # | BACH1, Gene ID: 571 |
|---|
| Catalog # | NBP2-55113 |
|---|
| Price | |
|---|
| Order / More Info | BACH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|