| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BACH1 |
|---|
| Clone | 1B8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BACH1 Antibody (1B8) from Novus Biologicals is a mouse monoclonal antibody to BACH1. This antibody reacts with human, mouse. The BACH1 Antibody (1B8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | BACH1 (NP_996749 396 a.a. - 492 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC |
|---|
| Other Names | basic region leucine zipper transcriptional regulator BACH1, BTB and CNC homolog 1, BTB and CNC homology 1, basic leucine zipper transcription factor 1, HA2303, transcription regulator protein BACH1, transcription regulator protein10BACH-1 |
|---|
| Gene, Accession # | BACH1, Gene ID: 571, Accession: NP_996749, SwissProt: NP_996749 |
|---|
| Catalog # | H00000571-M02 |
|---|
| Price | |
|---|
| Order / More Info | BACH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27836987 |
|---|
| 产品资料 |
|
|