| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IYD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IYD Antibody from Novus Biologicals is a rabbit polyclonal antibody to IYD. This antibody reacts with human. The IYD Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IYD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK |
|---|
| Other Names | C6orf71, DEHAL1chromosome 6 open reading frame 71, dJ422F24.1, iodotyrosine dehalogenase 1, iodotyrosine deiodinase, IYD-1, TDH4 |
|---|
| Gene, Accession # | IYD, Gene ID: 389434, Accession: Q6PHW0, SwissProt: Q6PHW0 |
|---|
| Catalog # | NBP2-31786 |
|---|
| Price | |
|---|
| Order / More Info | IYD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|