| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DC8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DC8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DC8. This antibody reacts with human. The DC8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DC8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMD SDIKVLEDQFDEIIVDIATKRKQYP |
|---|
| Other Names | C1orf48, chromosome 1 open reading frame 48, DC8, DKFZP566O1646, kinetochore-associated protein NSL1 homolog, MIS14, NSL1, MIND kinetochore complex component, homolog (S. cerevisiae) |
|---|
| Gene, Accession # | NSL1, Gene ID: 25936 |
|---|
| Catalog # | NBP2-13678 |
|---|
| Price | |
|---|
| Order / More Info | DC8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|