| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Decorin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Decorin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Decorin. This antibody reacts with human. The Decorin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Decorin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY |
|---|
| Other Names | Bone proteoglycan II, CSCD, decorin, decorin proteoglycan, dermatan sulphate proteoglycans II, DSPG2, PG40, PGII, PG-S2, proteoglycan core protein, SLRR1BPGS2, small leucine-rich protein 1B |
|---|
| Gene, Accession # | DCN, Gene ID: 1634 |
|---|
| Catalog # | NBP2-56346 |
|---|
| Price | |
|---|
| Order / More Info | Decorin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|