| Edit |   |
|---|
| Antigenic Specificity | Abhydrolase Domain Containing 12 (ABHD12) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ABHD12 may be a regulator of endocannabinoid signaling pathways. |
|---|
| Immunogen | ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH |
|---|
| Other Names | ABHD12|1500011G07Rik|6330583M11Rik|AI431047|AW547313|ABHD12A|BEM46L2|C20orf22|PHARC|dJ965G21.2 |
|---|
| Gene, Accession # | Gene ID: 26090 |
|---|
| Catalog # | ABIN635357 |
|---|
| Price | |
|---|
| Order / More Info | Abhydrolase Domain Containing 12 (ABHD12) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|