| 产品详情 |
| Edit |   |
| Antigenic Specificity | CACNA1S |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CACNA1S Antibody from Novus Biologicals is a rabbit polyclonal antibody to CACNA1S. This antibody reacts with human. The CACNA1S Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CACNA1S antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL |
| Other Names | CACH1, CACN1, CACNL1A3MHS5, calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle, Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle, calcium channel, voltage-dependent, L type, alpha 1S subunit, Cav1.1, CCHL1A3, dihydropyridine receptor, dihydropyridine-sensitive L-type calcium channel alpha-1 subunit, HOKPP, HOKPP1, hypokalemic periodic paralysis), hypoPP, TTPP1, voltage-dependent L-type calcium channel subunit alpha-1S, Voltage-gated calcium channel subunit alpha Cav1.1 |
| Gene, Accession # | CACNA1S, Gene ID: 779, Accession: Q13698, SwissProt: Q13698 |
| Catalog # | NBP2-33799 |
| Price | |
| Order / More Info | CACNA1S Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|